Pay in 4 interest-free payments of $51.92 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
mouse LIX/CXCL5 should be stable up to 1 week at 4°C or up to 2 months at -20°C
the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity
using CES3 antibody at 1:3000 dilution
LLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQR
BTK (phospho-Y223) Rabbit Monoclonal Antibody -BS9948M Size:50µl mouse LIX/CXCL5 should be stableBTK (phospho Y223) Rabbit Monoclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS9948M 50, BS9948M 100 Product: Rabbit IgG, 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q06187 Host: Rabbit Reactivity: Human Applications: WB All Applications: WB: 1: 1000 1: 2000 Background: Brutons tyrosine kinase (BTK) is a member of the BTK Tec family of cytoplasmic tyrosine kinases. Like other BTK family members, it contains a
US$ 39.90
US$ 111.00
US$ 124.79
US$ 128.00
US$ 99.90
US$ 137.00
US$ 63.95
US$ 143.00
US$ 89.90